PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G035700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 400aa    MW: 42003 Da    PI: 7.4793
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G035700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.6e-10127189163
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         eke kr rr   NRe+Ar   +R++a  +eL++kv  L+++N+ +kke ++  +e+ +lk  +
  Sevir.8G035700.1.p 127 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVVDLSSQNENMKKEKDMVMQEYLSLKEAN 189
                         89**********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001704.4E-8127190IPR004827Basic-leucine zipper domain
SMARTSM003381.9E-11127191IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.864129192IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.93E-6131187No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-4131187No hitNo description
CDDcd147021.12E-13132182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MSDDSDGQRQ CRRGVTVDVE LDAAMALADM AGVGPAATPG GGNHPRPSHQ AAAAAPPTAE  60
GEDDLASTRL SLELGKVGIQ SASPCSSSSS AGHPHPQPSA QHQPHPVPEA AATGYGPRPR  120
HTLTEAEKEA KRLRRVLANR ESARQTILRR QAIRDELARK VVDLSSQNEN MKKEKDMVMQ  180
EYLSLKEANK QLKEQVARTT KKAPVTTAVT AAVPMHVAAA QQQAAEPMAA AAASPPATPP  240
QPGFLYTAAP PVPYVWGSWP PGAGYEHHHH HGSPPPALCL PPCAWYYPVV ADPRGSPSAA  300
YAGTQQQQQA AFQPEPAGSG GGSPAGGATA EEDTDDDPCS LTLGLDIAAD KRSMPHLPPG  360
MGLSDRDKAA TAAEARKRRK ELTKLKHMHA AGRPGAEQW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1375380RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9585021e-115EU958502.1 Zea mays clone 1697405 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669858.11e-128PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like
TrEMBLK3ZIQ00.0K3ZIQ0_SETIT; Uncharacterized protein
STRINGSi026452m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.16e-19bZIP family protein